PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 472196
Common NameARALYDRAFT_472196
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family TALE
Protein Properties Length: 532aa    MW: 60044.6 Da    PI: 6.2109
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
472196genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.4e-103664031954
               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
               Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
    472196 366 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 403
               664459******************************88 PP

2BELL119.51.5e-38226297172
    BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
             er+elq+kk+kLl++++eVdkrY+qy++q+++++ssFe+vaglgsak Yts+Al++iSrhFr+L+dai+eqi
  472196 226 EREELQNKKNKLLTMVDEVDKRYNQYYHQMEALASSFEIVAGLGSAKAYTSVALNRISRHFRALRDAIKEQI 297
             799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.9E-48154295IPR006563POX domain
PfamPF075263.2E-45160293IPR006563POX domain
PROSITE profilePS5007112.455344407IPR001356Homeobox domain
CDDcd000867.91E-12347408No hitNo description
SMARTSM003895.4E-10347411IPR001356Homeobox domain
SuperFamilySSF466891.71E-17348414IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28350413IPR009057Homeodomain-like
PfamPF059206.6E-18364403IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MAVYYPSNVG CYQQEPIFLN HQQQQASSSS AAASFTVTGS DNVRNEMVFI PPTTTGDVVT  60
GNGAVSSSDL SFHDGQGLSL SLGTQISVAP FHFHQYQLGF TQNPSTSVKE TSPFNVDEMS  120
VKSKEMMLLS QSDPSSGYAG SGFYNNYRYN ETSGGFMSSV LRSRYLKPAQ NLLDEVVSVK  180
KELNQMGKKK MKVNDFNNGS KEIEGGGSGE LSNDLNGKSM ELSTVEREEL QNKKNKLLTM  240
VDEVDKRYNQ YYHQMEALAS SFEIVAGLGS AKAYTSVALN RISRHFRALR DAIKEQIQII  300
REKLGEKGGE SLDEQQGERI PRLRYLDQRL RQQRALHQQL GMVRPAWRPQ RGLPENSVSV  360
LRAWLFEHFL HPYPKESEKI MLAKQTGLSK NQVANWFINA RVRLWKPMIE EMYKEEFGDE  420
SELLISKSSQ EPNSTNQEDS SSQQQQQQEN NNNLTYSSAD TTNIVFSSET KPDRVLGNDN  480
EPQQPQINRS SDYDTLMNYH GFGVDDYRYI SGSNQQESRF SNSHHLHDFV V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16353411563Homeobox protein Meis2
3k2a_B4e-16353411563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5705080.0AY570508.1 Arabidopsis thaliana BEL1-like homeodomain 5 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002893062.10.0hypothetical protein ARALYDRAFT_472196
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLD7KI490.0D7KI49_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.1__2150__AT1G19700.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.30.0BEL1-like homeodomain 10